PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009761269.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 500aa    MW: 56842.6 Da    PI: 4.8892
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009761269.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS272.31.5e-831174852373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgd....pmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPil 91 
                     ++lLl  Aea+++g+l la+ ++ rl+++ s + +    p+ Rla yft++L  + ++ s++el ++ + +     +ss++++a+++++e+sP++
  XP_009761269.1 117 TDLLLMGAEAIEAGNLDLASVVVLRLNTILSDQENrensPIDRLALYFTQGLLYKSLStSSHELLNQNQFQ----PESSSSITAFQMLQEISPYV 207
                     5789999********************996666544555************97665551444444333333....4578999************* PP

            GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                     kf+h+taNqaIlea++g+++vHi+Dfdi +G+QWp+L+  L +R +   slRiT+v+  +++++  +++tg+rL++fA+++++pf f+ +  ++ 
  XP_009761269.1 208 KFAHFTANQAILEATKGSQQVHILDFDILEGIQWPPLMVDLVERGNINSSLRITAVVV-DKNNSFLVQKTGKRLQEFADSINLPFMFDQVFLTKD 301
                     *********************************************************9.667999************************866666 PP

            GRAS 187 edleleeL.rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe....adhnsesFlerflealeyysalfdsleaklp 276
                     edl  e++  v+++ +l+ n++++  +++++  sl +    + + +++lsPkvvv+ve+e    ++  + sF+e f+eal++y+++ ds+  +++
  XP_009761269.1 302 EDL--ENIqGVESHNNLIANVMIHQLHIPQRGSSLVK---IFFNGLRRLSPKVVVLVEEElfnlTKIPTMSFVEFFCEALHHYTTISDSILGGFG 391
                     665..777246669*********9999*988888888...9*******************7554455778********************66666 PP

            GRAS 277 res.eerikvErellgreivnvvacegaerrerhetlekWrerlee.aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                          + +++E+e+lg +i ++v +  +e+ er    ekW+e l +  GF+++p+s++++ qak+l++ ++  gy v++e+  l l+Wk+rpL++
  XP_009761269.1 392 GGYkLALRVIEKEFLGVRILDCVRQFPSEKSER----EKWSEGLYSlKGFRQIPMSSSNVRQAKHLVSLFS-GGYWVQNEHCKLALCWKSRPLTT 481
                     65538999********************96666....56***997658***********************.89********************* PP

            GRAS 370 vSaW 373
                     +S W
  XP_009761269.1 482 ASIW 485
                     **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.72190467IPR005202Transcription factor GRAS
PfamPF035145.2E-81117485IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MEYENFQPTY MNPFLEYSNL ETTFSLKNSS INPHCSIQDF VTVVNDVDIQ DYFQNDFDFI  60
DRDVDFPVQN SQKFPLFSSQ VLVQEDTGFL KEGKKLRVYS PELKLLQDQL MEETSITDLL  120
LMGAEAIEAG NLDLASVVVL RLNTILSDQE NRENSPIDRL ALYFTQGLLY KSLSTSSHEL  180
LNQNQFQPES SSSITAFQML QEISPYVKFA HFTANQAILE ATKGSQQVHI LDFDILEGIQ  240
WPPLMVDLVE RGNINSSLRI TAVVVDKNNS FLVQKTGKRL QEFADSINLP FMFDQVFLTK  300
DEDLENIQGV ESHNNLIANV MIHQLHIPQR GSSLVKIFFN GLRRLSPKVV VLVEEELFNL  360
TKIPTMSFVE FFCEALHHYT TISDSILGGF GGGYKLALRV IEKEFLGVRI LDCVRQFPSE  420
KSEREKWSEG LYSLKGFRQI PMSSSNVRQA KHLVSLFSGG YWVQNEHCKL ALCWKSRPLT  480
TASIWVPTSS SSSPSSSISF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2915648539374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009761269.10.0PREDICTED: nodulation-signaling pathway 2 protein-like
TrEMBLK4D4H40.0K4D4H4_SOLLC; Uncharacterized protein
STRINGSolyc11g005610.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA133661417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.12e-43GRAS family protein